PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn081581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HSF
Protein Properties Length: 343aa    MW: 37483.3 Da    PI: 4.4097
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn081581genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind72.11e-2289141961
                   HHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
  HSF_DNA-bind   9 iledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 
                   +++d++++++isw+++g++fvv++++efa+++LpkyFkh+nf+SFvRQLn+Y 
    Achn081581  89 LVDDPSIDDVISWNDDGSTFVVWNPTEFARDLLPKYFKHNNFSSFVRQLNTYR 141
                   789*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000567.9E-1082105IPR000232Heat shock factor (HSF)-type, DNA-binding
SMARTSM004157.2E-1689230IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004477.7E-1989141IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467854.08E-2189141IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.101.1E-2289143IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000567.9E-10120132IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000567.9E-10133145IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MEGLLKRIMR FMNHIELTIE HQGETRINDD GSLSPARGRF EDSTVDAKHA EAMSSALKEV  60
ASSSGKNSQL SGGWTSSDDD ADPMDQDGLV DDPSIDDVIS WNDDGSTFVV WNPTEFARDL  120
LPKYFKHNNF SSFVRQLNTY RRKVAAPAAA VAVPLMVAAL PAPPAPQGTG SPSNSGEEQV  180
ISSNSSPANA PTLCRETSFG STTTELVDEN ERLKKENMQL NKELSQMKNL CNNIYALMSN  240
YTGNRPESGS QAAKPLDLMP PKQAGDEADG KPEDATRLFG VSIGAKRLRE DEDEAAEQHE  300
ELQLQLGGVE VKSEPFDHRN AGDDEETPWL RQCNPTNQRV CN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B4e-14891453693Heat shock factor protein 1
5d5v_B4e-14891453693Heat shock factor protein 1
5d5v_D4e-14891453693Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076201.12e-88PREDICTED: heat stress transcription factor B-2a-like
RefseqXP_011076202.12e-88PREDICTED: heat stress transcription factor B-2a-like
SwissprotQ9SCW42e-66HFB2A_ARATH; Heat stress transcription factor B-2a
TrEMBLA0A068VLL83e-87A0A068VLL8_COFCA; Uncharacterized protein
STRINGGLYMA09G26510.11e-78(Glycine max)
STRINGGLYMA16G32070.12e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21822460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62020.13e-61heat shock transcription factor B2A